Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXTL2 Peptide - middle region

EXTL2 Peptide - middle region

Product Specifications

Product Name Alternative

EXTR2

UniProt

Q9UBQ6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXTL2 Rabbit Polyclonal Antibody (orb588597) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028197.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGM

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR13C4 Protein Vector (Human) (pPB-C-His)
PV106130 500 ng

OR13C4 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
TYSND1, CT (TYSND1, Peroxisomal leader peptide-processing protease, Trypsin domain-containing protein 1, Peroxisomal leader peptide-processing protease, 15kD form, Peroxisomal leader peptide-processing protease, 45kD form) (FITC) discontinued
043492-FITC 200 µL

TYSND1, CT (TYSND1, Peroxisomal leader peptide-processing protease, Trypsin domain-containing protein 1, Peroxisomal leader peptide-processing protease, 15kD form, Peroxisomal leader peptide-processing protease, 45kD form) (FITC) discontinued

Sign In for Pricing
View Details
CD20 Rabbit pAb
MBS8542251-01 0.1 mL

CD20 Rabbit pAb

Sign In for Pricing
View Details
CD20 Rabbit pAb
MBS8542251-02 0.1 mL (AF405L)

CD20 Rabbit pAb

Sign In for Pricing
View Details
CD20 Rabbit pAb
MBS8542251-03 0.1 mL (AF405S)

CD20 Rabbit pAb

Sign In for Pricing
View Details
CD20 Rabbit pAb
MBS8542251-04 0.1 mL (AF610)

CD20 Rabbit pAb

Sign In for Pricing
View Details