FCGR2A Peptide - middle region
FCGR2A Peptide - middle region
Product Specifications
Product Name Alternative
CD32, FCG2, FcGR, CD32A, CDw32, FCGR2, IGFR2, FCGR2A1
UniProt
P12318
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FCGR2A Rabbit Polyclonal Antibody (orb55757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001129691.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881045-100 1x 100 µL
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470525-500 1x 500 µL
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940499-500 1x 500 µL
Cytokeratin 14 (LL002), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880354-500 1x 500 µL
AFP (Alpha Fetoprotein) (C3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040488-100 1x 100 µL
Topoisomerase I, MT (TOP1MT/488), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details