Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF14 Peptide - N-terminal region

FGF14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FHF4, FHF-4, SCA27, FGF-14

UniProt

Q92915

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGF14 Rabbit Polyclonal Antibody (orb588601) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004106.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZAP70 Blocking Peptide
MBS8309393-01 1 mg

ZAP70 Blocking Peptide

Sign In for Pricing
View Details
ZAP70 Blocking Peptide
MBS8309393-02 5 mg

ZAP70 Blocking Peptide

Sign In for Pricing
View Details
ZAP70 Blocking Peptide
MBS8309393-03 5x 5 mg

ZAP70 Blocking Peptide

Sign In for Pricing
View Details
Mmu-miR-483-3p miRNA Mimic
orb1875933-01 5 nmol

Mmu-miR-483-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-483-3p miRNA Mimic
orb1875933-02 10 nmol

Mmu-miR-483-3p miRNA Mimic

Sign In for Pricing
View Details
Recombinant Human Coiled-coil domain-containing protein 108 (CCDC108) , partial
MBS7089571 Inquire

Recombinant Human Coiled-coil domain-containing protein 108 (CCDC108) , partial

Sign In for Pricing
View Details