Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF14 Peptide - N-terminal region

FGF14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FHF4, FHF-4, SCA27, FGF-14

UniProt

Q92915

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGF14 Rabbit Polyclonal Antibody (orb588601) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004106.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COLONNESÈCHE250X26CARD-T1-P4 Pipe Markers for Fire Systems
N002088 4 Card (4 Marker (s) x 1 Card)

COLONNESÈCHE250X26CARD-T1-P4 Pipe Markers for Fire Systems

Sign In for Pricing
View Details
EEF1A1P31 Protein Vector (Human) (pPB-C-His)
PV074841 500 ng

EEF1A1P31 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Argonaute 2 (AGO2) (NM_012154) Human Over-expression Lysate
LH08706V 100 µg

Argonaute 2 (AGO2) (NM_012154) Human Over-expression Lysate

Sign In for Pricing
View Details
Dde-NH-Pr-OH
sc-294275 5 g

Dde-NH-Pr-OH

Sign In for Pricing
View Details
LAMP1, NT (LAMP1, Lysosome-associated membrane glycoprotein 1, CD107 antigen-like family member A, CD107a) (MaxLight 490) discontinued
037669-ML490 100 µL

LAMP1, NT (LAMP1, Lysosome-associated membrane glycoprotein 1, CD107 antigen-like family member A, CD107a) (MaxLight 490) discontinued

Sign In for Pricing
View Details
hsa-miR-548as-3p miRNA Inhibitor
MBS8294594-01 10 nmol

hsa-miR-548as-3p miRNA Inhibitor

Sign In for Pricing
View Details