TNFAIP1 Peptide - middle region
TNFAIP1 Peptide - middle region
Product Specifications
Product Name Alternative
B12, B61, EDP1, BTBD34, hBACURD2
UniProt
F8WGQ9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TNFAIP1 Rabbit Polyclonal Antibody (orb588693) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_066960.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYSYTSNSDDHLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402113-100 1x 100 µL
Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
