OR2H2 Peptide - C-terminal region
OR2H2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FAT11, OLFR2, OR2H3, OLFR42B, hs6M1-12, dJ271M21.2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR2H2 Rabbit Polyclonal Antibody (orb55761) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_009091.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFRRLLGKEM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC743439-100 1x 100 µL
Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP720342 10 µg
Cathepsin E (CTSE) (NM_001910) Human Recombinant Protein
Sign In for Pricing
View Details 
