Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2H2 Peptide - C-terminal region

OR2H2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAT11, OLFR2, OR2H3, OLFR42B, hs6M1-12, dJ271M21.2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2H2 Rabbit Polyclonal Antibody (orb55761) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009091.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFRRLLGKEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VWA5A Antibody
KC-2732-01 50 μL

VWA5A Antibody

Sign In for Pricing
View Details
VWA5A Antibody
KC-2732-02 100 µL

VWA5A Antibody

Sign In for Pricing
View Details
VWA5A Antibody
KC-2732-03 1 mL

VWA5A Antibody

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053), CF555 conjugate, 0.1mg/mL
BNC550681-500 1x 500 µL

Human Kappa Light Chain (HP6053), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Butyn-1-ol
TRC-B809750-250G 250 g

3-Butyn-1-ol

Sign In for Pricing
View Details
Anillin (ANLN) (NM_018685) Human Recombinant Protein
TP762267 50 µg

Anillin (ANLN) (NM_018685) Human Recombinant Protein

Sign In for Pricing
View Details