Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A5 Peptide - C-terminal region

SLC7A5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

E16, CD98, LAT1, 4F2LC, MPE16, hLAT1, D16S469E

UniProt

Q3UG45

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC7A5 Rabbit Polyclonal Antibody (orb588704) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003477.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HES6 Antibody
MBS5316353-01 0.1 mL

HES6 Antibody

Sign In for Pricing
View Details
HES6 Antibody
MBS5316353-02 5x 0.1 mL

HES6 Antibody

Sign In for Pricing
View Details
Mouse Transglutaminase 2/TGM2 Recombinant Protein
PROTP21981-500ug 500 µg

Mouse Transglutaminase 2/TGM2 Recombinant Protein

Sign In for Pricing
View Details
Guinea pig nicotinamide adenine dinucleotide (NADH) ELISA Kit
EIA07185Gu 1 Kit

Guinea pig nicotinamide adenine dinucleotide (NADH) ELISA Kit

Sign In for Pricing
View Details
Galectin 7 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-5809R-APC-Cy5.5 100 µL

Galectin 7 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
TIMP2 CytoSection
TS409796P5 25 Slides

TIMP2 CytoSection

Sign In for Pricing
View Details