Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A5 Peptide - C-terminal region

SLC7A5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

E16, CD98, LAT1, 4F2LC, MPE16, hLAT1, D16S469E

UniProt

Q3UG45

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC7A5 Rabbit Polyclonal Antibody (orb588704) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003477.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PPIL3 (His)
orb3067859 50 µg

Recombinant Human PPIL3 (His)

Sign In for Pricing
View Details
alpha 1d Adrenergic Receptor (ADRA1D) Human shRNA Plasmid Kit (Locus ID 146)
TR314915 1 Kit

alpha 1d Adrenergic Receptor (ADRA1D) Human shRNA Plasmid Kit (Locus ID 146)

Sign In for Pricing
View Details
OVOL1 AAV Vector (Rat) (CMV)
35834106 1 µg

OVOL1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
CpcE Antibody
PHY5110S 150 μg

CpcE Antibody

Sign In for Pricing
View Details
Dld 3'UTR Luciferase Stable Cell Line
TU105176 1.0 mL

Dld 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
LRP3 (D-8) FITC
sc-373736 FITC 200 µg/mL

LRP3 (D-8) FITC

Sign In for Pricing
View Details