Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAE1 Peptide - middle region

NAE1 Peptide - middle region

Product Specifications

Product Name Alternative

HPP1, ula-1, APPBP1, A-116A10.1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAE1 Rabbit Polyclonal Antibody (orb588722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001018169.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl (phenylthio) acetate
orb3031143-01 200 mg

Ethyl (phenylthio) acetate

Sign In for Pricing
View Details
Ethyl (phenylthio) acetate
orb3031143-02 1 g

Ethyl (phenylthio) acetate

Sign In for Pricing
View Details
5-Bromo-2-chloro-6-fluorobenzo[D]thiazole
GDD32514-01 50 mg

5-Bromo-2-chloro-6-fluorobenzo[D]thiazole

Sign In for Pricing
View Details
5-Bromo-2-chloro-6-fluorobenzo[D]thiazole
GDD32514-02 0.5 g

5-Bromo-2-chloro-6-fluorobenzo[D]thiazole

Sign In for Pricing
View Details
Heat Shock Factor Protein 1 (HSF1) Antibody (FITC)
abx445543 100 µg

Heat Shock Factor Protein 1 (HSF1) Antibody (FITC)

Sign In for Pricing
View Details
SARS-CoV-2 (COVID-19) Spike 681P Antibody
9091-01mg 0.1 mg

SARS-CoV-2 (COVID-19) Spike 681P Antibody

Sign In for Pricing
View Details