NAE1 Peptide - middle region
NAE1 Peptide - middle region
Product Specifications
Product Name Alternative
HPP1, ula-1, APPBP1, A-116A10.1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NAE1 Rabbit Polyclonal Antibody (orb588722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001018169.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS650567-01 0.002 mg
Interleukin 1 beta, Recombinant, Mouse (IL-1b)
Sign In for Pricing
View Details MBS650567-02 0.01 mg
Interleukin 1 beta, Recombinant, Mouse (IL-1b)
Sign In for Pricing
View Details MBS650567-03 5x 0.01 mg
Interleukin 1 beta, Recombinant, Mouse (IL-1b)
Sign In for Pricing
View Details 
bsm-61367R-PerCP-TR 20 µL
CBR1 Recombinant Antibody, PerCP Conjugated
Sign In for Pricing
View Details 
GTR15376503 1 Vial
Lentiviral human SGIP1 sgRNA gene knockout kit - Lentiviral human SGIP1 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details IRBAHUPGRIN2BAP37120UL 1 Each
Rabbit Anti Human Phospho-GRIN2B(Y1474) Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot)
Sign In for Pricing
View Details