Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAM2 Peptide - middle region

STAM2 Peptide - middle region

Product Specifications

Product Name Alternative

Hbp, STAM2A, STAM2B

UniProt

O88811

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAM2 Rabbit Polyclonal Antibody (orb588754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005834.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QFSLISATIKSMKEEGITFPPAGSQTVSAAAKNGTSSNKNKEDEDIAKAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Bromo-N, N-dimethylaniline
431211-01 25 g

4-Bromo-N, N-dimethylaniline

Sign In for Pricing
View Details
4-Bromo-N, N-dimethylaniline
431211-02 50 g

4-Bromo-N, N-dimethylaniline

Sign In for Pricing
View Details
ATP6V0D1 Rabbit Monoclonal Antibody
AMRe87752-01 1 Each

ATP6V0D1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ATP6V0D1 Rabbit Monoclonal Antibody
AMRe87752-02 50 µL

ATP6V0D1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ATP6V0D1 Rabbit Monoclonal Antibody
AMRe87752-03 100 µL

ATP6V0D1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PRKDC Polyclonal Antibody
MBS8527372-01 0.1 mL

PRKDC Polyclonal Antibody

Sign In for Pricing
View Details