HGH1 Peptide - middle region
HGH1 Peptide - middle region
Product Specifications
Product Name Alternative
BRP16, BRP16L, FAM203A, FAM203B, C8orf30A, C8orf30B
UniProt
Q8C3I8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HGH1 Rabbit Polyclonal Antibody (orb55764) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057542.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LRNCCFEHRHHEWLLGPEVDILPFLLLPLAGPEDFSEEEMERLPVDLQYL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
032285 200 µL
ATP5H, ID (ATP5H, ATP synthase subunit d, mitochondrial)
Sign In for Pricing
View Details