Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HGH1 Peptide - middle region

HGH1 Peptide - middle region

Product Specifications

Product Name Alternative

BRP16, BRP16L, FAM203A, FAM203B, C8orf30A, C8orf30B

UniProt

Q8C3I8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HGH1 Rabbit Polyclonal Antibody (orb55764) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057542.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRNCCFEHRHHEWLLGPEVDILPFLLLPLAGPEDFSEEEMERLPVDLQYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTCry mAb2
MBS478094-01 1 mg

BTCry mAb2

Sign In for Pricing
View Details
BTCry mAb2
MBS478094-02 2 mg

BTCry mAb2

Sign In for Pricing
View Details
BTCry mAb2
MBS478094-03 5 mg

BTCry mAb2

Sign In for Pricing
View Details
BTCry mAb2
MBS478094-04 10 mg

BTCry mAb2

Sign In for Pricing
View Details
BTCry mAb2
MBS478094-05 20 mg

BTCry mAb2

Sign In for Pricing
View Details
RCV1 (Recoverin, RCV1) (MaxLight 550)
MBS6218939-01 0.1 mL

RCV1 (Recoverin, RCV1) (MaxLight 550)

Sign In for Pricing
View Details