Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUL2 Peptide - C-terminal region

CUL2 Peptide - C-terminal region

Product Specifications

UniProt

Q13617

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CUL2 Rabbit Polyclonal Antibody (orb331560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003582

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-CrkII (Tyr221) Rabbit Monoclonal Antibody
MBS1750274-01 0.03 mL

Anti-Phospho-CrkII (Tyr221) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-CrkII (Tyr221) Rabbit Monoclonal Antibody
MBS1750274-02 0.1 mL

Anti-Phospho-CrkII (Tyr221) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-CrkII (Tyr221) Rabbit Monoclonal Antibody
MBS1750274-03 5x 0.1 mL

Anti-Phospho-CrkII (Tyr221) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Wbscr27 siRNA Oligos set (Mouse)
50287174 3x 5 nmol

Wbscr27 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
TOMM20
MBS8533868-01 0.1 mL

TOMM20

Sign In for Pricing
View Details
TOMM20
MBS8533868-02 0.1 mL (AF405L)

TOMM20

Sign In for Pricing
View Details