Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUL2 Peptide - C-terminal region

CUL2 Peptide - C-terminal region

Product Specifications

UniProt

Q13617

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CUL2 Rabbit Polyclonal Antibody (orb331560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003582

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HoxC6 Rabbit Monoclonal Antibody
orb1993326 100 µL

HoxC6 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Monkey Apolipoprotein D (APOD) ELISA Kit
abx359528-01 96 Tests

Monkey Apolipoprotein D (APOD) ELISA Kit

Sign In for Pricing
View Details
Monkey Apolipoprotein D (APOD) ELISA Kit
abx359528-02 5x 96 Tests

Monkey Apolipoprotein D (APOD) ELISA Kit

Sign In for Pricing
View Details
Monkey Apolipoprotein D (APOD) ELISA Kit
abx359528-03 10x 96 Tests

Monkey Apolipoprotein D (APOD) ELISA Kit

Sign In for Pricing
View Details
SLC12A3 Peptide - middle region (AAP43742)
AAP43742-100UG 100 µg

SLC12A3 Peptide - middle region (AAP43742)

Sign In for Pricing
View Details
Mouse Monoclonal ICAM-3/CD50 Antibody (76203) [DyLight 594]
FAB8131M 0.1 mL

Mouse Monoclonal ICAM-3/CD50 Antibody (76203) [DyLight 594]

Sign In for Pricing
View Details