Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP1 Peptide - C-terminal region

CASP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ICE, P45, IL1BC

UniProt

P29466

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASP1 Rabbit Polyclonal Antibody (orb584186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150636.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLNTKNCPSLKDKPKVIIIQACRGDNVSWRHPTMGSVFIGRLIEHMQEYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Triglyceride (TG) ELISA Kit
KTE70365-01 48 Tests

Mouse Triglyceride (TG) ELISA Kit

Sign In for Pricing
View Details
Mouse Triglyceride (TG) ELISA Kit
KTE70365-02 96 Tests

Mouse Triglyceride (TG) ELISA Kit

Sign In for Pricing
View Details
Mouse Triglyceride (TG) ELISA Kit
KTE70365-03 5x 96 Tests

Mouse Triglyceride (TG) ELISA Kit

Sign In for Pricing
View Details
Mouse Triglyceride (TG) ELISA Kit
KTE70365-04 50x 96 Tests

Mouse Triglyceride (TG) ELISA Kit

Sign In for Pricing
View Details
PRDM10, ID (PRDM10, KIAA1231, PFM7, TRIS, PR domain zinc finger protein 10, PR domain-containing protein 10, Tristanin) (Azide free) (HRP)
MBS6337043-01 0.2 mL

PRDM10, ID (PRDM10, KIAA1231, PFM7, TRIS, PR domain zinc finger protein 10, PR domain-containing protein 10, Tristanin) (Azide free) (HRP)

Sign In for Pricing
View Details
PRDM10, ID (PRDM10, KIAA1231, PFM7, TRIS, PR domain zinc finger protein 10, PR domain-containing protein 10, Tristanin) (Azide free) (HRP)
MBS6337043-02 5x 0.2 mL

PRDM10, ID (PRDM10, KIAA1231, PFM7, TRIS, PR domain zinc finger protein 10, PR domain-containing protein 10, Tristanin) (Azide free) (HRP)

Sign In for Pricing
View Details