Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP1 Peptide - C-terminal region

CASP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ICE, P45, IL1BC

UniProt

P29466

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASP1 Rabbit Polyclonal Antibody (orb584186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150636.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLNTKNCPSLKDKPKVIIIQACRGDNVSWRHPTMGSVFIGRLIEHMQEYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GPR177/WLS Protein
NBP2-22947 0.05 mg

Recombinant Human GPR177/WLS Protein

Sign In for Pricing
View Details
SREBF1 (Sterol Regulatory Element Binding Transcription Factor 1, SREBP-1c, SREBP1, bHLHd1) (MaxLight 750) discontinued
252086-ML750 100 µL

SREBF1 (Sterol Regulatory Element Binding Transcription Factor 1, SREBP-1c, SREBP1, bHLHd1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
COQ7 Protein, Human, Recombinant (His Tag)
MBS8121119-01 0.1 mg

COQ7 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
COQ7 Protein, Human, Recombinant (His Tag)
MBS8121119-02 5x 0.1 mg

COQ7 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Rabbit anti-human Hepatitis A virus cellular receptor 2 polyclonal Antibody, FITC
MBS1488918-01 0.05 mg

Rabbit anti-human Hepatitis A virus cellular receptor 2 polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human Hepatitis A virus cellular receptor 2 polyclonal Antibody, FITC
MBS1488918-02 0.1 mg

Rabbit anti-human Hepatitis A virus cellular receptor 2 polyclonal Antibody, FITC

Sign In for Pricing
View Details