Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB9 Peptide - C-terminal region

SERPINB9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PI9, CAP3, PI-9, CAP-3

UniProt

P50453

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINB9 Rabbit Polyclonal Antibody (orb331023) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004146

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human S100 Calcium Binding Protein A10 (S100A10) ELISA Kit
RD-S100A10-Hu-01 96 Tests

Human S100 Calcium Binding Protein A10 (S100A10) ELISA Kit

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein A10 (S100A10) ELISA Kit
RD-S100A10-Hu-02 48 Tests

Human S100 Calcium Binding Protein A10 (S100A10) ELISA Kit

Sign In for Pricing
View Details
Alpha-Aminoacetophenone (Mixed Salt, >85%)
TRC-A580085-25G 25 g

Alpha-Aminoacetophenone (Mixed Salt, >85%)

Sign In for Pricing
View Details
4-Methyl-N- (5-methyl-2-pyridinyl) benzamide
IM25877-01 25 mg

4-Methyl-N- (5-methyl-2-pyridinyl) benzamide

Sign In for Pricing
View Details
4-Methyl-N- (5-methyl-2-pyridinyl) benzamide
IM25877-02 50 mg

4-Methyl-N- (5-methyl-2-pyridinyl) benzamide

Sign In for Pricing
View Details
4-Methyl-N- (5-methyl-2-pyridinyl) benzamide
IM25877-03 100 mg

4-Methyl-N- (5-methyl-2-pyridinyl) benzamide

Sign In for Pricing
View Details