Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX3 Peptide - middle region

STX3 Peptide - middle region

Product Specifications

Product Name Alternative

STX3A

UniProt

Q13277

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STX3 Rabbit Polyclonal Antibody (orb584366) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171511.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibitor hsa-miR-4441 AAV miRNA Vector
Amh3143300 500 ng

Inhibitor hsa-miR-4441 AAV miRNA Vector

Sign In for Pricing
View Details
CRTAM Rabbit Polyclonal Antibody
orb580741 100 µL

CRTAM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NVP-BHG712
S2202-50mg 50 mg

NVP-BHG712

Sign In for Pricing
View Details
PRKCI CRISPRa sgRNA lentivector (set of three targets)(Rat)
37644126 3x 1.0µg DNA

PRKCI CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
TAF10 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
46068124 3x 1.0µg DNA

TAF10 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal CD63 Antibody (MX-49.129.5) [Allophycocyanin/Cy7]
NBP2-34689APCCY7 0.1 mL

Mouse Monoclonal CD63 Antibody (MX-49.129.5) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details