Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX3 Peptide - middle region

STX3 Peptide - middle region

Product Specifications

Product Name Alternative

STX3A

UniProt

Q13277

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STX3 Rabbit Polyclonal Antibody (orb584366) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171511.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Kallikrein 1-related peptidase b5 (Klk1b5)
MBS1217799-01 0.02 mg (Mammalian-Cell)

Recombinant Mouse Kallikrein 1-related peptidase b5 (Klk1b5)

Sign In for Pricing
View Details
Recombinant Mouse Kallikrein 1-related peptidase b5 (Klk1b5)
MBS1217799-02 0.1 mg (Mammalian-Cell)

Recombinant Mouse Kallikrein 1-related peptidase b5 (Klk1b5)

Sign In for Pricing
View Details
Recombinant Mouse Kallikrein 1-related peptidase b5 (Klk1b5)
MBS1217799-03 1 mg (Mammalian-Cell)

Recombinant Mouse Kallikrein 1-related peptidase b5 (Klk1b5)

Sign In for Pricing
View Details
SPG21 Antibody
E308669 200 µL

SPG21 Antibody

Sign In for Pricing
View Details
F2 (Coagulation Factor II, Prothrombin)
126540 100 µg

F2 (Coagulation Factor II, Prothrombin)

Sign In for Pricing
View Details
RASGRP1 Antibody
E910495 100 µL

RASGRP1 Antibody

Sign In for Pricing
View Details