Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRGPRD Peptide - C-terminal region

MRGPRD Peptide - C-terminal region

Product Specifications

Product Name Alternative

MRGD, TGR7

UniProt

Q8TDS7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRGPRD Rabbit Polyclonal Antibody (orb584507) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_944605

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM4 (NM_002896) Human Over-expression Lysate
LY419041 100 µg

RBM4 (NM_002896) Human Over-expression Lysate

Sign In for Pricing
View Details
p53 (TP53) pThr18 Rabbit Polyclonal Antibody
AP08002PU-S 50 µL

p53 (TP53) pThr18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C14orf148 (NOXRED1) Human Gene Knockout Kit (CRISPR)
KN418665 1 Kit

C14orf148 (NOXRED1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-101
BCPS-101 1 Unit

Large Capacity Water Purification System BCPS-101

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS710313 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
CD45RA (Leukocyte Marker) (K4B5), CF488A conjugate, 0.1mg/mL
BNC881680-500 1x 500 µL

CD45RA (Leukocyte Marker) (K4B5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details