Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRGPRD Peptide - C-terminal region

MRGPRD Peptide - C-terminal region

Product Specifications

Product Name Alternative

MRGD, TGR7

UniProt

Q8TDS7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRGPRD Rabbit Polyclonal Antibody (orb584507) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_944605

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BrdU (Bromodeoxyuridine) (BU20a), 0.2mg/mL
BNUB0522-500 1x 500 µL

BrdU (Bromodeoxyuridine) (BU20a), 0.2mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), 1mg/mL
BNUM1819-50 1x 50 µL

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), 1mg/mL

Sign In for Pricing
View Details
Texas Red Conjugated Rabbit Polyclonal Antibody to Equine IgG
TA-2355-2 2 mL

Texas Red Conjugated Rabbit Polyclonal Antibody to Equine IgG

Sign In for Pricing
View Details
Slc28a1 Mouse Gene Knockout Kit (CRISPR)
KN516018 1 Kit

Slc28a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Hydroxybenzylamine Hydrochloride
TRC-H809745-1G 1 g

N-Hydroxybenzylamine Hydrochloride

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS622069 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details