Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLC1 Peptide - C-terminal region

KLC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KLC, KNS2, KNS2A

UniProt

Q07866

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLC1 Rabbit Polyclonal Antibody (orb584917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005543.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGTSFGEYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PAK2 Mouse mAb
MBS475928-01 0.1 mL

Anti-PAK2 Mouse mAb

Sign In for Pricing
View Details
Anti-PAK2 Mouse mAb
MBS475928-02 5x 0.1 mL

Anti-PAK2 Mouse mAb

Sign In for Pricing
View Details
Anti-CTLA-4 (botensilimab biosimilar) mAb
12-90084-50 50 µg

Anti-CTLA-4 (botensilimab biosimilar) mAb

Sign In for Pricing
View Details
AR alpha2C Polyclonal Antibody
MBS9242752-01 0.1 mL

AR alpha2C Polyclonal Antibody

Sign In for Pricing
View Details
AR alpha2C Polyclonal Antibody
MBS9242752-02 5x 0.1 mL

AR alpha2C Polyclonal Antibody

Sign In for Pricing
View Details
Rabl3 3'UTR Lenti-reporter-Luc Vector
38390086 1.0 µg

Rabl3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details