Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLC1 Peptide - C-terminal region

KLC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KLC, KNS2, KNS2A

UniProt

Q07866

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLC1 Rabbit Polyclonal Antibody (orb584917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005543.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGTSFGEYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MUC5AC Antibody (2-11M1) [DyLight 680]
NBP3-11418FR 0.1 mL

Mouse Monoclonal MUC5AC Antibody (2-11M1) [DyLight 680]

Sign In for Pricing
View Details
Gstm7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7060506 1.0 µg DNA

Gstm7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Cardiac Troponin C Rabbit Monoclonal Antibody
orb866115 100 µL

Cardiac Troponin C Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HMOX2, NT (HMOX2, HO2, Heme oxygenase 2) (MaxLight 650) discontinued
036652-ML650 100 µL

HMOX2, NT (HMOX2, HO2, Heme oxygenase 2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
SNX24 Rabbit Polyclonal Antibody (Center)
E28PB1277 100 µL

SNX24 Rabbit Polyclonal Antibody (Center)

Sign In for Pricing
View Details
Angiotensin II (3-8), human (TFA)
HY-P1515A-01 5 mg

Angiotensin II (3-8), human (TFA)

Sign In for Pricing
View Details