Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH2D2A Peptide - middle region

SH2D2A Peptide - middle region

Product Specifications

Product Name Alternative

SCAP, TSAD, VRAP, F2771

UniProt

Q9NP31

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH2D2A Rabbit Polyclonal Antibody (orb55763) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001154914.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (T-Helper/Inducer Cell Marker) (CD4/3026), CF640R conjugate, 0.1mg/mL
BNC403026-500 1x 500 µL

CD4 (T-Helper/Inducer Cell Marker) (CD4/3026), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®660R-dCTP, lyophilized powder
#40068 1x 25 nmol

CF®660R-dCTP, lyophilized powder

Sign In for Pricing
View Details
AQP12B Human Gene Knockout Kit (CRISPR)
KN415306 1 Kit

AQP12B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (HMB45), CF740 conjugate, 0.1mg/mL
BNC740444-100 1x 100 µL

Pmel17 / gp100 / SILV (HMB45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SPTY2D1 Human Gene Knockout Kit (CRISPR)
KN423508 1 Kit

SPTY2D1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: 123C3.D5 + 123A8]
AM50240PU-S 100 µg

CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: 123C3.D5 + 123A8]

Sign In for Pricing
View Details