Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH2D2A Peptide - middle region

SH2D2A Peptide - middle region

Product Specifications

Product Name Alternative

SCAP, TSAD, VRAP, F2771

UniProt

Q9NP31

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH2D2A Rabbit Polyclonal Antibody (orb55763) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001154914.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79A (202-216) Mouse Monoclonal Antibody [Clone ID: HM57]
AM01322PU-S 100 µg

CD79A (202-216) Mouse Monoclonal Antibody [Clone ID: HM57]

Sign In for Pricing
View Details
TTLL5 Rabbit Polyclonal Antibody
TA370817 100 µL

TTLL5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD66 (CEA) (C66/1009), CF640R conjugate, 0.1mg/mL
BNC401009-100 1x 100 µL

CD66 (CEA) (C66/1009), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP2 Mouse Monoclonal Antibody [Clone ID: 3A4]
AM05382PU-N 200 µg

TIMP2 Mouse Monoclonal Antibody [Clone ID: 3A4]

Sign In for Pricing
View Details
Evaporation Loss Tester BPTL-206
BPTL-206 1 Unit

Evaporation Loss Tester BPTL-206

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (B22.1), CF640R conjugate, 0.1mg/mL
BNC401266-100 1x 100 µL

Cytokeratin 8 (KRT8) (B22.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details