ARHGEF9 Peptide - C-terminal region
ARHGEF9 Peptide - C-terminal region
Product Specifications
Product Name Alternative
9630036L12Rik
UniProt
A0A0G2JEH1
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARHGEF9 Rabbit Polyclonal Antibody (orb589025) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001166950.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KRQAAMTVRKASKQKGVNSARSVPPSYPPPQDPLNQGQYLVPDGIAQSQV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Fibronectin Recombinant Rabbit Monoclonal Antibody [JF0582]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82b3a/imageurl/et1702-25.webp)
ET1702-25 100 µL
Fibronectin Recombinant Rabbit Monoclonal Antibody [JF0582]
Sign In for Pricing
View Details 
1357-AAT 2 Labelings
Buccutite™ Rapid PE-iFluor® 710 Tandem Antibody Labeling Kit *Microscale Optimized for Labeling 25 ug Antibody Per Reaction*
Sign In for Pricing
View Details 
BNC042385-500 1x 500 µL
CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details