Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGEF9 Peptide - C-terminal region

ARHGEF9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

9630036L12Rik

UniProt

A0A0G2JEH1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARHGEF9 Rabbit Polyclonal Antibody (orb589025) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001166950.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRQAAMTVRKASKQKGVNSARSVPPSYPPPQDPLNQGQYLVPDGIAQSQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCHSD1 Rabbit Polyclonal Antibody
TA376188 100 µL

FCHSD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARGFX (NM_001012659) Human Over-expression Lysate
LY422893 100 µg

ARGFX (NM_001012659) Human Over-expression Lysate

Sign In for Pricing
View Details
p53 (TP53) pSer46 Rabbit Polyclonal Antibody
AP01659PU-N 100 µg

p53 (TP53) pSer46 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Ethyl-2,5-dihydro-5-oxo-3-furanacetic Acid
TRC-E947660-100MG 100 mg

4-Ethyl-2,5-dihydro-5-oxo-3-furanacetic Acid

Sign In for Pricing
View Details
Rfx6 Mouse Gene Knockout Kit (CRISPR)
KN514710 1 Kit

Rfx6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tafenoquine
TRC-T004765-5MG 5 mg

Tafenoquine

Sign In for Pricing
View Details