What is the catalog number for LAPTM5 Peptide - middle region?

The catalog number for LAPTM5 Peptide - middle region is orb2001122.

What sizes are available for LAPTM5 Peptide - middle region?

LAPTM5 Peptide - middle region is available in the following size(s): 100 µg.

Is LAPTM5 Peptide - middle region in stock?

LAPTM5 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

LAPTM5 Peptide - middle region

Product Specifications

Product Name Alternative

Gcd-10

UniProt

Q6P9Z7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_445990

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CSSYMEVPTYLNFKSMNHMNYLPSQEGMPRSQFINMMLIFSVAFITVLIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PV088667 500 ng

KDELC1P1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing

View Details

orb350363-01 50 µg

CLDN15 Antibody (FITC)

Sign In for Pricing

View Details

orb350363-02 100 µg

CLDN15 Antibody (FITC)

Sign In for Pricing

View Details

GWB-MN902B 50 µg

Pcdh10 Antibody

Sign In for Pricing

View Details

K2226905 3x 1.0 µg

SNORD31 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing

View Details

A10166-01 100 μL

SMUG1 Rabbit pAb

Sign In for Pricing

View Details