Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAPTM5 Peptide - middle region

LAPTM5 Peptide - middle region

Product Specifications

Product Name Alternative

Gcd-10

UniProt

Q6P9Z7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_445990

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CSSYMEVPTYLNFKSMNHMNYLPSQEGMPRSQFINMMLIFSVAFITVLIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HPV16 L1/Major capsid protein L1 Protein, N-GST & C-His
MBS1576219-01 0.1 mg

Recombinant HPV16 L1/Major capsid protein L1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant HPV16 L1/Major capsid protein L1 Protein, N-GST & C-His
MBS1576219-02 1 mg

Recombinant HPV16 L1/Major capsid protein L1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant HPV16 L1/Major capsid protein L1 Protein, N-GST & C-His
MBS1576219-03 5x 1 mg

Recombinant HPV16 L1/Major capsid protein L1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Olig1 Antibody - middle region : FITC (ARP45900_P050-FITC)
ARP45900_P050-FITC 100 µL

Olig1 Antibody - middle region : FITC (ARP45900_P050-FITC)

Sign In for Pricing
View Details
5-Chloro-1-methyl-1H-pyrazole-3-carboxylic acid
YWB24676-01 100 mg

5-Chloro-1-methyl-1H-pyrazole-3-carboxylic acid

Sign In for Pricing
View Details
5-Chloro-1-methyl-1H-pyrazole-3-carboxylic acid
YWB24676-02 1 g

5-Chloro-1-methyl-1H-pyrazole-3-carboxylic acid

Sign In for Pricing
View Details