Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMB7 Peptide - middle region

PSMB7 Peptide - middle region

Product Specifications

Product Name Alternative

Z

UniProt

Q99436

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMB7 Rabbit Polyclonal Antibody (orb589075) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002790.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cruz Tag 41™ (CZ-C) Alexa Fluor® 546
sc-8055 AF546 200 µg/mL

Cruz Tag 41™ (CZ-C) Alexa Fluor® 546

Sign In for Pricing
View Details
Rabbit Polyclonal Nudel Antibody [Alexa Fluor 750]
NBP1-76677AF750 0.1 mL

Rabbit Polyclonal Nudel Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Recombinant Rat Muscarinic acetylcholine receptor M3 (Chrm3)
MBS7011437-01 0.02 mg

Recombinant Rat Muscarinic acetylcholine receptor M3 (Chrm3)

Sign In for Pricing
View Details
Recombinant Rat Muscarinic acetylcholine receptor M3 (Chrm3)
MBS7011437-02 0.1 mg

Recombinant Rat Muscarinic acetylcholine receptor M3 (Chrm3)

Sign In for Pricing
View Details
Recombinant Rat Muscarinic acetylcholine receptor M3 (Chrm3)
MBS7011437-03 5x 0.1 mg

Recombinant Rat Muscarinic acetylcholine receptor M3 (Chrm3)

Sign In for Pricing
View Details
TBA8 rabbit pAb
ES10738-01 50 µL

TBA8 rabbit pAb

Sign In for Pricing
View Details