PSMB7 Peptide - middle region
PSMB7 Peptide - middle region
Product Specifications
Product Name Alternative
Z
UniProt
Q99436
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PSMB7 Rabbit Polyclonal Antibody (orb589075) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002790.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AM3517 2 OD, 4 OD, 50 OD
MIRacle™ mmu-miR-6969-5p miRNA Agomir/Antagomir
Sign In for Pricing
View Details 
MBS1169565-01 0.05 mg (E-Coli)
Recombinant Rhodobacter sphaeroides Peptide chain release factor 1 (prfA)
Sign In for Pricing
View Details MBS1169565-02 0.05 mg (Yeast)
Recombinant Rhodobacter sphaeroides Peptide chain release factor 1 (prfA)
Sign In for Pricing
View Details MBS1169565-03 0.05 mg (Baculovirus)
Recombinant Rhodobacter sphaeroides Peptide chain release factor 1 (prfA)
Sign In for Pricing
View Details MBS1169565-04 0.2 mg (E-Coli)
Recombinant Rhodobacter sphaeroides Peptide chain release factor 1 (prfA)
Sign In for Pricing
View Details MBS1169565-05 0.5 mg (E-Coli)
Recombinant Rhodobacter sphaeroides Peptide chain release factor 1 (prfA)
Sign In for Pricing
View Details