Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL23 Peptide - middle region

MRPL23 Peptide - middle region

Product Specifications

Product Name Alternative

RPL23, L23MRP, RPL23L

UniProt

Q16540

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL23 Rabbit Polyclonal Antibody (orb589076) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066957.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMCR7L Blocking Peptide
33R-3147 100 ug

SMCR7L Blocking Peptide

Sign In for Pricing
View Details
Rat Bin1  ELISA Kit
EF018392 96 Tests

Rat Bin1 ELISA Kit

Sign In for Pricing
View Details
Goat Polyclonal MCM3 Antibody [Alexa Fluor 405]
NB100-249AF405 0.1 mL

Goat Polyclonal MCM3 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Tert-Butyl 5-bromo-3-chloro-2-fluorobenzoate
PC99040-01 500 mg

Tert-Butyl 5-bromo-3-chloro-2-fluorobenzoate

Sign In for Pricing
View Details
Tert-Butyl 5-bromo-3-chloro-2-fluorobenzoate
PC99040-02 1 g

Tert-Butyl 5-bromo-3-chloro-2-fluorobenzoate

Sign In for Pricing
View Details
4- (3-Nitro-2-pyridinyl) benzenecarbaldehyde
sc-314380A 1 g

4- (3-Nitro-2-pyridinyl) benzenecarbaldehyde

Sign In for Pricing
View Details