Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL23 Peptide - middle region

MRPL23 Peptide - middle region

Product Specifications

Product Name Alternative

RPL23, L23MRP, RPL23L

UniProt

Q16540

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL23 Rabbit Polyclonal Antibody (orb589076) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066957.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLAMF6 Lentiviral Activation Particles (h)
sc-409009-LAC 200 µL

SLAMF6 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
RhD Double Nickase Plasmid (h)
sc-405163-NIC 20 µg

RhD Double Nickase Plasmid (h)

Sign In for Pricing
View Details
LIMK-1 Lentiviral Activation Particles (h)
sc-401057-LAC 200 µL

LIMK-1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Recombinant Human FCRL4 Protein, N-His
orb3150050-01 50 µg

Recombinant Human FCRL4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human FCRL4 Protein, N-His
orb3150050-02 100 µg

Recombinant Human FCRL4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human FCRL4 Protein, N-His
orb3150050-03 1 mg

Recombinant Human FCRL4 Protein, N-His

Sign In for Pricing
View Details