SNRPD3 Peptide - middle region
SNRPD3 Peptide - middle region
Product Specifications
Product Name Alternative
SMD3, Sm-D3
UniProt
P62318
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNRPD3 Rabbit Polyclonal Antibody (orb589077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001265585.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY423189 100 µg
C14orf174 (SAMD15) (NM_001010860) Human Over-expression Lysate
Sign In for Pricing
View Details 
![KMT5A Mouse Monoclonal Antibody [Clone ID: OTI2B3]](https://cdn.genprice.uk/products/937/68dd18b9061270361e908281/imageurl/cf808204.webp)
