Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPD3 Peptide - middle region

SNRPD3 Peptide - middle region

Product Specifications

Product Name Alternative

SMD3, Sm-D3

UniProt

P62318

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNRPD3 Rabbit Polyclonal Antibody (orb589077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001265585.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKL4 Polyclonal Antibody
E-AB-19685-01 20 µL

CDKL4 Polyclonal Antibody

Sign In for Pricing
View Details
CDKL4 Polyclonal Antibody
E-AB-19685-02 60 µL

CDKL4 Polyclonal Antibody

Sign In for Pricing
View Details
CDKL4 Polyclonal Antibody
E-AB-19685-03 120 µL

CDKL4 Polyclonal Antibody

Sign In for Pricing
View Details
CDKL4 Polyclonal Antibody
E-AB-19685-04 200 µL

CDKL4 Polyclonal Antibody

Sign In for Pricing
View Details
C-Jun (Ab-91) Antibody
8B7132-AAT 50 µg

C-Jun (Ab-91) Antibody

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3295), 0.2mg/mL
BNUB3295-100 1x 100 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3295), 0.2mg/mL

Sign In for Pricing
View Details