Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBPL2 Peptide - N-terminal region

OSBPL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ORP2, ORP-2, DFNA67, DNFA67

UniProt

Q9H1P3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OSBPL2 Rabbit Polyclonal Antibody (orb589087) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055650.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRTSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH9-AS2 ORF Vector (Human) (pORF)
ORF027471 1.0 µg DNA

PCDH9-AS2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lentiviral human OR6C3 sgRNA gene knockout kit - Lentiviral human OR6C3 sgRNA gene knockout kit (100)
GTR15375292 1 Vial

Lentiviral human OR6C3 sgRNA gene knockout kit - Lentiviral human OR6C3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
APEX2 Knockout Hela Polyclonal Cells
ARG37630 1 Million

APEX2 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Rabbit Polyclonal to Human NTSR2 / NTR2
MBS243236-01 0.05 mg

Rabbit Polyclonal to Human NTSR2 / NTR2

Sign In for Pricing
View Details
Rabbit Polyclonal to Human NTSR2 / NTR2
MBS243236-02 5x 0.05 mg

Rabbit Polyclonal to Human NTSR2 / NTR2

Sign In for Pricing
View Details
B-Raf Rabbit pAb (APR20515N)
APR20515N-01 50 µL

B-Raf Rabbit pAb (APR20515N)

Sign In for Pricing
View Details