Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBPL2 Peptide - N-terminal region

OSBPL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ORP2, ORP-2, DFNA67, DNFA67

UniProt

Q9H1P3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OSBPL2 Rabbit Polyclonal Antibody (orb589087) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055650.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRTSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CREB1 Antibody
RC-5146-01 50 μL

Recombinant CREB1 Antibody

Sign In for Pricing
View Details
Recombinant CREB1 Antibody
RC-5146-02 100 µL

Recombinant CREB1 Antibody

Sign In for Pricing
View Details
Recombinant CREB1 Antibody
RC-5146-03 1 mL

Recombinant CREB1 Antibody

Sign In for Pricing
View Details
Scratch 2 Rabbit Polyclonal Antibody (AP)
orb965242 100 µL

Scratch 2 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Recombinant Human Melanoma antigen preferentially expressed in tumors (PRAME)
orb1651189-01 20 µg

Recombinant Human Melanoma antigen preferentially expressed in tumors (PRAME)

Sign In for Pricing
View Details
Recombinant Human Melanoma antigen preferentially expressed in tumors (PRAME)
orb1651189-02 100 µg

Recombinant Human Melanoma antigen preferentially expressed in tumors (PRAME)

Sign In for Pricing
View Details