ACOT1 Peptide - middle region
ACOT1 Peptide - middle region
Product Specifications
Product Name Alternative
ACH2, CTE-1, LACH2
UniProt
Q86TX2
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACOT1 Rabbit Polyclonal Antibody (orb589088) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001032238.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKPQIICYPETG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2502304 1.0 µg DNA
TRNAL25 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
TRV-0043172-01 10 µg
Recombinant T-Cell Surface Glycoprotein CD3 Gamma (CD3g)
Sign In for Pricing
View Details TRV-0043172-02 50 µg
Recombinant T-Cell Surface Glycoprotein CD3 Gamma (CD3g)
Sign In for Pricing
View Details TRV-0043172-03 100 µg
Recombinant T-Cell Surface Glycoprotein CD3 Gamma (CD3g)
Sign In for Pricing
View Details TRV-0043172-04 200 µg
Recombinant T-Cell Surface Glycoprotein CD3 Gamma (CD3g)
Sign In for Pricing
View Details TRV-0043172-05 500 µg
Recombinant T-Cell Surface Glycoprotein CD3 Gamma (CD3g)
Sign In for Pricing
View Details