FBXO6 Peptide - N-terminal region
FBXO6 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FBG2, FBS2, FBX6, Fbx6b
UniProt
Q9H4M3
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FBXO6 Rabbit Polyclonal Antibody (orb589093) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060908.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TGFBI Mouse Monoclonal Antibody [Clone ID: OTI9A11]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907d0c/imageurl/cf805390.webp)
CF805390 100 µg
TGFBI Mouse Monoclonal Antibody [Clone ID: OTI9A11]
Sign In for Pricing
View Details 
HP227899 200 Reactions
Ataxin 3 (ATXN3) Human qPCR Primer Pair (NM_004993)
Sign In for Pricing
View Details ![PE Anti-Human CD3 Antibody[UCHT1]](https://cdn.genprice.uk/products/763/68dd14b3061270361e7d44e9/imageurl/e-ab-f1230d.webp)
