Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO6 Peptide - N-terminal region

FBXO6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FBG2, FBS2, FBX6, Fbx6b

UniProt

Q9H4M3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO6 Rabbit Polyclonal Antibody (orb589093) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060908.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Mouse IL-17A Antibody[TC11-18H10.1]
E-AB-F1199A-01 25 µg

Purified Anti-Mouse IL-17A Antibody[TC11-18H10.1]

Sign In for Pricing
View Details
Purified Anti-Mouse IL-17A Antibody[TC11-18H10.1]
E-AB-F1199A-02 100 µg

Purified Anti-Mouse IL-17A Antibody[TC11-18H10.1]

Sign In for Pricing
View Details
N-Nitroso Avacopan
TRC-N356880-50MG 50 mg

N-Nitroso Avacopan

Sign In for Pricing
View Details
LARP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E2]
TA813304AM 100 µL

LARP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E2]

Sign In for Pricing
View Details
Human ACE2 activation kit by CRISPRa (Angiotensin Converting Enzyme 2)
GA111814 1 Kit

Human ACE2 activation kit by CRISPRa (Angiotensin Converting Enzyme 2)

Sign In for Pricing
View Details
Human CRP Recombinant Rabbit Monoclonal Antibody [PSH04-26] - BSA and Azide free (Detector)
HA722109 100 µL

Human CRP Recombinant Rabbit Monoclonal Antibody [PSH04-26] - BSA and Azide free (Detector)

Sign In for Pricing
View Details