TSPAN9 Peptide - C-terminal region
TSPAN9 Peptide - C-terminal region
Product Specifications
Product Name Alternative
NET5, NET-5, PP1057
UniProt
O75954
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TSPAN9 Rabbit Polyclonal Antibody (orb589133) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001161792.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CYEKVKMWFDDNKHVLGTVGMCILIMQILGMAFSMTLFQHIHRTGKKYDA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740923-500 1x 500 µL
Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-D975410-100MG 100 mg
4-(1,4-Dihydro-2,4-dioxo-3(2H)-quinazolinyl)-benzeneacetic Acid
Sign In for Pricing
View Details 