TRIM40 Peptide - middle region
TRIM40 Peptide - middle region
Product Specifications
Product Name Alternative
RNF35
UniProt
Q6P9F5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM40 Rabbit Polyclonal Antibody (orb589143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001273562.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-13664R-BF350 100 µL
SOCS5 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
Sign In for Pricing
View Details 
MBS6147499-01 0.1 mL
GTF2H1 (BTF2, General Transcription Factor IIH Subunit 1, Basic Transcription Factor 2 62kD Subunit, General Transcription Factor IIH Polypeptide 1, TFIIH Basal Transcription Factor Complex p62 Subunit) (FITC)
Sign In for Pricing
View Details MBS6147499-02 5x 0.1 mL
GTF2H1 (BTF2, General Transcription Factor IIH Subunit 1, Basic Transcription Factor 2 62kD Subunit, General Transcription Factor IIH Polypeptide 1, TFIIH Basal Transcription Factor Complex p62 Subunit) (FITC)
Sign In for Pricing
View Details 
14267091 4x 500 ng
C20orf103-set siRNA/shRNA/RNAi Lentivector (Human)
Sign In for Pricing
View Details