TRIM40 Peptide - middle region
TRIM40 Peptide - middle region
Product Specifications
Product Name Alternative
RNF35
UniProt
Q6P9F5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM40 Rabbit Polyclonal Antibody (orb589143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001273562.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
F3464 96 Tests
Neuronal Acetylcholine Receptor subunit alpha-4 (CHRNA4) Mouse ELISA Kit
Sign In for Pricing
View Details 
FY-EM2248S 96 Well
Easypro Mouse Thyroid Stimulating Hormone Receptor Antibody (TSHR-Ab) ELISA Kit
Sign In for Pricing
View Details 
bs-15037R-PE-Cy5 100 µL
C1orf172 Polyclonal Antibody, PE-Cy5 Conjugated
Sign In for Pricing
View Details