TRIM40 Peptide - middle region
TRIM40 Peptide - middle region
Product Specifications
Product Name Alternative
RNF35
UniProt
Q6P9F5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM40 Rabbit Polyclonal Antibody (orb589143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001273562.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RP00796 10 µg
Recombinant Cynomolgus CD38/ADP-ribosyl Cyclase 1/cyclic ADP-ribose Hydrolase 1 Protein
Sign In for Pricing
View Details 
KTE10407-01 48 Tests
ELISA kit for Bovine Serine/threonine-protein kinase PLK1 (PLK1)
Sign In for Pricing
View Details KTE10407-02 96 Tests
ELISA kit for Bovine Serine/threonine-protein kinase PLK1 (PLK1)
Sign In for Pricing
View Details KTE10407-03 5x 96 Well
ELISA kit for Bovine Serine/threonine-protein kinase PLK1 (PLK1)
Sign In for Pricing
View Details orb1665651-01 48 Tests
Chicken Insulin Like Growth Factor Binding Protein 2 (IGFBP2) ELISA Kit
Sign In for Pricing
View Details