Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PUDP Peptide - middle region

PUDP Peptide - middle region

Product Specifications

Product Name Alternative

GS1, HDHD1, HDHD1A, FAM16AX, DXF68S1E

UniProt

Q08623

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PUDP Rabbit Polyclonal Antibody (orb589144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129037.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZP1 siRNA Oligos set (Human)
51943171 3x 5 nmol

ZP1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
C4orf49 siRNA Oligos set (Human)
14549171 3x 5 nmol

C4orf49 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), CF488A conjugate, 0.1mg/mL
BNC882240-500 1x 500 µL

Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nfyc (NM_012866) Rat Tagged Lenti ORF Clone
RR207420L4 10 µg

Nfyc (NM_012866) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-PLXNA1 Polyclonal Antibody
HV036014-01 50 µg

Anti-PLXNA1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-PLXNA1 Polyclonal Antibody
HV036014-02 100 µg

Anti-PLXNA1 Polyclonal Antibody

Sign In for Pricing
View Details