Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PUDP Peptide - middle region

PUDP Peptide - middle region

Product Specifications

Product Name Alternative

GS1, HDHD1, HDHD1A, FAM16AX, DXF68S1E

UniProt

Q08623

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PUDP Rabbit Polyclonal Antibody (orb589144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129037.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human recombinant FasL (Fas ligand) protein, AF
PROTP48023-4-5ug 5 µg

Human recombinant FasL (Fas ligand) protein, AF

Sign In for Pricing
View Details
Cdk2/Cdc2 (phospho Thr160) rabbit pAb
ES1465-01 50 µL

Cdk2/Cdc2 (phospho Thr160) rabbit pAb

Sign In for Pricing
View Details
Cdk2/Cdc2 (phospho Thr160) rabbit pAb
ES1465-02 100 µL

Cdk2/Cdc2 (phospho Thr160) rabbit pAb

Sign In for Pricing
View Details
IFRD2 Polyclonal Antibody, PE-Cy5 Conjugated
bs-15557R-PE-Cy5 100 µL

IFRD2 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Rat Rgs10 Pre-designed siRNA Set A
SI211856A 1 Each

Rat Rgs10 Pre-designed siRNA Set A

Sign In for Pricing
View Details
P38 MAPK antibody (Thr179)
70R-34324 100 ug

P38 MAPK antibody (Thr179)

Sign In for Pricing
View Details