CUEDC1 Peptide - N-terminal region
CUEDC1 Peptide - N-terminal region
Product Specifications
UniProt
Q9NWM3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CUEDC1 Rabbit Polyclonal Antibody (orb55667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060419
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RANSGAVDATIDQLLQMNLEGGGSSGGVYEDSSDSEDSIPPEILERTLEP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![beta Defensin 3 (DEFB103A) (6-22) Mouse Monoclonal Antibody [Clone ID: L3-18b-E1]](https://cdn.genprice.uk/products/937/68dd1899061270361e8fb920/imageurl/am02222pu-n.webp)
AM02222PU-N 100 µg
beta Defensin 3 (DEFB103A) (6-22) Mouse Monoclonal Antibody [Clone ID: L3-18b-E1]
Sign In for Pricing
View Details 
BNC883157-500 1x 500 µL
S100A9 + Calprotectin (S100A8/A9 Complex) (MAC3157R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 