CUEDC1 Peptide - N-terminal region
CUEDC1 Peptide - N-terminal region
Product Specifications
UniProt
Q9NWM3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CUEDC1 Rabbit Polyclonal Antibody (orb55667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060419
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RANSGAVDATIDQLLQMNLEGGGSSGGVYEDSSDSEDSIPPEILERTLEP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881619-500 1x 500 µL
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472087-100 1x 100 µL
HNF1A (Pancreatic Tumor Suppressor) (HNF1A/2087), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1991-500 1x 500 µL
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC401391 20 µg
Calmegin (CLGN) (NM_004362) Human Over-expression Lysate
Sign In for Pricing
View Details ![Elab Fluor® Violet 500 Anti-Mouse F4/80 Antibody[CI:A3-1]](https://cdn.genprice.uk/products/763/68dd1496061270361e7cdb30/imageurl/e-ab-f0995ur.webp)
E-AB-F0995UR-01 25 µg
Elab Fluor® Violet 500 Anti-Mouse F4/80 Antibody[CI:A3-1]
Sign In for Pricing
View Details