ESCO2 Peptide - middle region
ESCO2 Peptide - middle region
Product Specifications
Product Name Alternative
RBS, EFO2, 2410004I17Rik
UniProt
Q56NI9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ESCO2 Rabbit Polyclonal Antibody (orb580431) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001017420
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
131625-ML550 100 µL
POU3F2 (BRN2, OCT7, OTF7, POU Domain, Class 3, Transcription Factor 2, Brain-specific Homeobox/POU Domain Protein 2, Nervous System-specific Octamer-binding Transcription Factor N-Oct-3, Octamer-binding Protein 7, Octamer-binding Transcription Factor 7) (MaxLight 550)
Sign In for Pricing
View Details 
GTR15279824 1 Vial
Lentiviral mouse Ska3 shRNA (UAS) - Lentiviral mouseSka3 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details